PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00054431001
Common NameGSBRNA2T00054431001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 385aa    MW: 43238.6 Da    PI: 7.4757
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00054431001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.5e-3447101155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprl+Wtp+LHerF+eav+qLGG++kAtPkti+++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00054431001  47 KPRLKWTPDLHERFIEAVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 101
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.22744104IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-3145102IPR009057Homeodomain-like
SuperFamilySSF466894.48E-1746102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2347102IPR006447Myb domain, plants
PfamPF002494.4E-1049100IPR001005SANT/Myb domain
PfamPF143793.4E-25148194IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MYYQNQHQGK SILSSSRMHL PSERHHQFLR GGNSPGGSGL ILSTDAKPRL KWTPDLHERF  60
IEAVNQLGGA DKATPKTIMK VMGIPGLTLY HLKSHLQKYR LSKNLNGQAN SGLNKIGMMT  120
MMEEKSPDAD EIQSETLSIG PQPNKNSPIS EALHMQIEVQ RRLHEQLEVQ RHLQLKIEAQ  180
GKYLQSVLEK AQETLGKQNL GEAGLEAAKV HLSEFVSKVS AEYPNTSFLE QKEFRNLCTQ  240
QMQPPDCSLE SCLTSSEGAQ KNPKTLENNR LGLRTYLGDS TSEQKEPMFK RMELTWTEGL  300
RGNPYLSTMV SDAEQRVSYS DRSPDRLSIG VGMHGHRGHQ QGNNNEDHKL ETQGTTTELD  360
LNTQVDNYCT TRPKQLDLNG FSWN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2220890.0HQ222089.1 Arabidopsis thaliana myb family transcription factor (MYR2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013742265.10.0PREDICTED: uncharacterized protein LOC106445296
TrEMBLA0A078JIE20.0A0A078JIE2_BRANA; BnaA01g37390D protein
STRINGBra036412.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.30.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]